ZNF443, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant ZNF443, Each
$ 1,069.20
|
|
Details:
Zinc finger proteins (ZNFs) bind DNA and, through this binding, regulate gene transcription. Most ZNFs contain conserved C2H2 motifs and are classified as Kruppel-type zinc fingers. For a general of these proteins, see ZNF91 (MIM 603971).[supplied by OMIMSequence: VALEDVAVNFTREEWALLGPCQKNLYKDVMQETIRNLDCVVMKWKDQNIEDQYRYPRKNLRCRMLERFVESKDGTQCGETSSQIQDSIVTKNTLPGVGPCESSMRGEKVMGHSSLNCYIRVGA
Additional Information
| SKU | 10286535 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB20171 |
