Znf443, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Znf443, Each
$ 1,757.70
|
|
Details
Zinc finger proteins (znfs) bind dna and, through this binding, regulate gene transcription. Most znfs contain conserved c2h2 motifs and are classified as kruppel-type zinc fingers. For a general of these proteins, see znf91 (mim 603971).[Supplied by omimsequence: valedvavnftreewallgpcqknlykdvmqetirnldcvvmkwkdqniedqyryprknlrcrmlerfveskdgtqcgetssqiqdsivtkntlpgvgpcessmrgekvmghsslncyirvga
Additional Information
| SKU | 10286535 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB20171 |
