Znf160, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Znf160, Each
$ 1,757.70
|
|
Details
The protein encoded by this gene is a kruppel-related zinc finger protein which is characterized by the presence of an n-terminal repressor domain, the kruppel-associated box (krab). The krab domain is a potent repressor of transcription; thus this protein may function in transcription regulation. Three alternative transcripts encoding the same protein have been described. [Provided by refseqsequence: lvslglchfdmniismleegkepwtvkscvkiarkprtrecvkgvvtdippkctikdllpkekssteavfhtvvlerhespdiedfsfkepqknvhdfecqwrddtgnykgvlmaqkegkrdqrdrrdienklmnnqlgvsfhshlp
Additional Information
| SKU | 10287776 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21594 |
