518-831-8000 sales@utechproducts.com

Znf160, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Znf160, Each

1,757.70

Details

The protein encoded by this gene is a kruppel-related zinc finger protein which is characterized by the presence of an n-terminal repressor domain, the kruppel-associated box (krab). The krab domain is a potent repressor of transcription; thus this protein may function in transcription regulation. Three alternative transcripts encoding the same protein have been described. [Provided by refseqsequence: lvslglchfdmniismleegkepwtvkscvkiarkprtrecvkgvvtdippkctikdllpkekssteavfhtvvlerhespdiedfsfkepqknvhdfecqwrddtgnykgvlmaqkegkrdqrdrrdienklmnnqlgvsfhshlp

Additional Information

SKU 10287776
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21594