Zfp57, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Zfp57, Each
$ 2,214.00
|
|
Details
The protein encoded by this gene is a zinc finger protein containing a krab domain. Studies in mouse suggest that this protein may function as a transcriptional repressor. Mutations in this gene have been associated with transient neonatal diabetes mellitus type 1 (tndm1)sequence: pelitkleqeeeqwrefvhlpnteglsegkkkelreqhpslrdegtsddkvflacrgagqcplsapagtmdrtrvlqasqagppf
Additional Information
| SKU | 10290192 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB24530 |
