Zdhhc15, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Zdhhc15, Each
$ 1,757.70
|
|
Details
The protein encoded by this gene belongs to the dhhc palmitoyltransferase family. Mutations in this gene are associated with mental retardatio x-linked type 91 (mrx91). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [Provided by refseqsequence: vsrnkttleafctpvftsgpekngfnlgfikniqqvfgdkkkfwlipigsspgdghsfpmrsmnesqnpllaneetwedneddnq
Additional Information
| SKU | 10287329 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21089 |
