Yod1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Yod1, Each
$ 1,757.70
|
|
Details
Deubiquitinating enzymes (dubs; see mim 603478) are proteases that specifically cleave ubiquitin (mim 191339) linkages, negating the action of ubiquitin ligases. Duba8 belongs to a dub subfamily characterized by an ovarian tumor (otu) domain.[Supplied by omimsequence: qrnfpdpdtppltifssnddivlvqaleladearrrrqftdvnrftlrcmvcqkgltgqaearehaketghtnfgev
Additional Information
| SKU | 10288257 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22152 |
