Xkr3, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Xkr3, Each
$ 1,757.70
|
|
Details
Xkrx (mim 300684) and xkr3 are homologs of the kell blood group precursor xk (mim 314850), which is a putative membrane transporter and a component of the xk/kell complex of the kell blood group system (calenda et al., 2006 [Pubmed 16431037]).[Supplied by omimsequence: tirnyhkwlknlkqekeetqvsitkrntmlereiafsirdnfmqqkafk
Additional Information
| SKU | 10288058 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21910 |
