Wipi2 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Wipi2, Each
$ 1,757.70
|
|
Details
Wd40 repeat proteins are key components of many essential biologic functions. They regulate the assembly of multiprotein complexes by presenting a beta-propeller platform for simultaneous and reversible protein-protein interactions. Members of the wipi subfamily of wd40 repeat proteins, such as wipi2, have a 7-bladed propeller structure and contain a conserved motif for interaction with phospholipids (proikas-cezanne et al., 2004 [Pubmed 15602573]).[Supplied by omimsequence: mkvlhtiretppnpaglcalsinndncylaypgsatigevqvfdtinlraanmipahdsplaalafdasgtklatasekgtvirvf
Additional Information
| SKU | 10287617 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21418 |
