Wipf2 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Wipf2, Each
$ 1,757.70
|
|
Details
This gene encodes a wasp interacting protein (wip)-related protein. It has been shown that this protein has a role in the wasp-mediated organization of the actin cytoskeleton and that this protein is a potential link between the activated platelet-derived growth factor receptor and the actin polymerization machinery. [Provided by refseqsequence: pppyrmhgseppsrgkpppppsrtpagpppppppplrnghrdsittvrsflddfeskysfhpvedfpapeeykhfq
Additional Information
| SKU | 10287873 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21701 |
