Wdr23, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Wdr23, Each
$ 1,757.70
|
|
Details
This gene encodes a wd repeat-containing protein that interacts with the cop9 signalosome, a macromolecular complex that interacts with cullin-ring e3 ligases and regulates their activity by hydrolyzing cullin-nedd8 conjugates. Multiple alternatively spliced transcript variants have been found for this gene. [Provided by refseq]sequence: nskdqtiklwdirrfssregmeasrqaatqqnwdyrwqqvpkkawrklklpgdsslmtyrghgvlhtlircrfspihstgqqfiysgcstgkvvvydllsghivkkltnhkacvrdvswhpfeekivssswdg
Additional Information
| SKU | 10288575 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22521 |
