Wbscr17, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Wbscr17, Each
$ 1,757.70
|
|
Details
This gene encodes an n-acetylgalactosaminyltransferase, which has 97% sequence identity to the mouse protein. This gene is deleted in williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. [Provided by refseqsequence: rpiavrsgdafheirpraevanlsahsaspiqdavlkrlslledivyrqlnglskslgliegyggrgkgglpatlspaeeekakgphekygynsylse
Additional Information
| SKU | 10286967 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB20665 |
