VILL, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant VILL, Each

$ 1,069.20
|
Details
The protein encoded by this gene belongs to the villin/gelsolin family. It contains 6 gelsolin-like repeats and a headpiece domain. It may play a role in actin-bundling. [provided by RefSeqSequence: IGWFFTWDPYKWTSHPSHKEVVDGSPAAASTISEITAEVNNLRLSRWPGNGRAGAVALQALKGSQDSSENDLVRSPKSAGSRTSSSV
Additional Information
SKU | 10288894 |
---|---|
UOM | Each |
UNSPSC | 12352203 |
Manufacturer Part Number | PAB22894 |