518-831-8000 sales@utechproducts.com

Vav1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Vav1, Each

1,757.70

Details

The protein encoded by this proto-oncogene is a member of the dbl family of guanine nucleotide exchange factors (gef) for the rho family of gtp binding proteins. The protein is important in hematopoiesis, playing a role in t-cell and b-cell development and activation. This particular gef has been identified as the specific binding partner of nef proteins from hiv-1. Coexpression and binding of these partners initiates profound morphological changes, cytoskeletal rearrangements and the jnk/sapk signaling cascade, leading to increased levels of viral transcription and replication. [Provided by refseqsequence: lswtpiaqnrgimpfpteeesvgdediysglsdqiddtveededlydcveneeaegdeiyedlmrsepvsmppkmteydkrccclreiqqteekytdtlgsiqqhflkplqrflkpqdieiifiniedllrvhthflkemkeal

Additional Information

SKU 10292379
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28500