518-831-8000 sales@utechproducts.com

USP36, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant USP36, Each

973.20

Details

Modification of cellular proteins by ubiquitin is an essential regulatory mechanism controlled by the coordinated action of multiple ubiquitin-conjugating and deubiquitinating enzymes. USP36 belongs to a large family of cysteine proteases that function as deubiquitinating enzymes (Quesada et al., 2004 [PubMed 14715245]).[supplied by OMIMSequence: DSLVHSSNVKVVLNQQAYVLFYLRIPGSKKSPEGLISRTGSSSLPGRPSVIPDHSKKNIGNGIISSPLTGKRQDSGTMKKPHTTEEIGVPISRNGSTLGLKSQNGCIPPKLPSGSPSPKLSQTPTHMPTILDDPGKKVKKPAPP

Additional Information

SKU 10282377
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20583