Uqcrq, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Uqcrq, Each
$ 2,214.00
|
|
Details
This gene encodes a ubiquinone-binding protein of low molecular mass. This protein is a small core-associated protein and a subunit of ubiquinol-cytochrome c reductase complex iii, which is part of the mitochondrial respiratory chain. [Provided by refseqsequence: refgnltrmrhvisyslspfeqrayphvftkgipnvlrr
Additional Information
| SKU | 10290176 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB24512 |
