518-831-8000 sales@utechproducts.com

Unc13a, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Unc13a, Each

1,356.75

Details

Proteins of the unc13 family, such as unc13a, are diacylglycerol and phorbol ester receptors with ligand affinities similar to those of protein kinase c (see prkca; mim 176960). Rodent unc13a is a presynaptic protein with an essential role in synaptic vesicle priming (rossner et al., 2004 [Pubmed 15123597]).[Supplied by omimsequence: qlsedfdpdehslqgsdmederdrdsyhschssvsyhkdsprwdqdeeeleedledfleeee

Additional Information

SKU 10282391
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23802