Tyw3 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Tyw3, Each
$ 1,757.70
|
|
Details
Wybutosine (yw) is a hypermodified guanosine at the 3-prime position adjacent to the anticodon of phenylalanine trna that stabilizes codon-anticodon interactions during decoding on the ribosome. Tyw3 is the human homolog of a yeast gene essential for yw synthesis (noma and suzuki, 2006).[Supplied by omimsequence: efrkwkaqclskadlsrkgsvdedvvelvqflnmrdqffttsscagrillldrgingfevqkqnccwllvthklcvkddviv
Additional Information
| SKU | 10288402 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22321 |
