Tysnd1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Tysnd1, Each
$ 1,757.70
|
|
Details
All peroxisomal proteins are synthesized in the cytosol, and 2 distinct peroxisomal targeting signals (ptss), the c-terminal pts1 and n-terminal pts2, are used for transport of these proteins into peroxisomes. Proteolytic cleavage of the n-terminal targeting sequence of pts2 proteins accompanies import into peroxisomes, and many pts1 proteins undergo c-terminal processing once in the peroxisomal matrix. Tysnd1 processes both pts1 and pts2 proteins involved in beta-oxidation of fatty acids (kurochkin et al., 2007 [Pubmed 17255948]).[Supplied by omimsequence: atqetcpydiavvsleedlddvpipvpaehfhegeavsvvgfgvfgqscgpsvtsgilsavvqvngtpvmlqttcav
Additional Information
| SKU | 10288775 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22755 |
