518-831-8000 sales@utechproducts.com

Tyrobp, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Tyrobp, Each

1,757.70

Details

This gene encodes a transmembrane signaling polypeptide which contains an immunoreceptor tyrosine-based activation motif (itam) in its cytoplasmic domain. The encoded protein may associate with the killer-cell inhibitory receptor (kir) family of membrane glycoproteins and may act as an activating signal transduction element. This protein may bind zeta-chain (tcr) associated protein kinase 70kda (zap-70) and spleen tyrosine kinase (syk) and play a role in signal transduction, bone modeling, brain myelination, and inflammation. Mutations within this gene have been associated with polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (plosl), also known as nasu-hakola disease. Its putative receptor, triggering receptor expressed on myeloid cells 2 (trem2), also causes plosl. Two alternative transcript variants encoding distinct isoforms have been identified for this gene. Other alternative splice variants have been described, but their full-length nature has not been deterimined. [Provided by refseqsequence: flgrlvprgrgaaeaatrkqritetespyqelqgqrsdvysdlntqrpyyk

Additional Information

SKU 10289754
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23872