Trib2, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Trib2, Each
|
|
Details
This gene encodes one of three members of the tribbles family. The tribbles members share a trb domain, which is homologous to protein serine-threonine kinases, but lacks the active site lysine and probably lacks a catalytic function. The tribbles proteins interact and modulate the activity of signal transduction pathways in a number of physiological and pathological processes. This tribbles member induces apoptosis of cells mainly of the hematopoietic origin. It has been identified as a protein up-regulated by inflammatory stimuli in myeloid (thp-1) cells, and also as an oncogene that inactivates the transcription factor c/ebpalpha (ccaat/enhancer-binding protein alpha) and causes acute myelogenous leukemia. Alternatively spliced transcript variants have been found for this gene. [Provided by refseqsequence: tiarygrsrnktqdfeelssirsaepsqsfspnlgspsppetpnlshcvscigkyllleplegdhvfravhlhsgeelvckvfdiscyqeslapcfclsahsninqiteiilgetkayvffersygdmhsfvrtckklre
Additional Information
| SKU | 10292294 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB28409 |
