Tpst2 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Tpst2, Each
$ 1,757.70
|
|
Details
The protein encoded by this gene catalyzes the o-sulfation of tyrosine residues within acidic regions of proteins. The encoded protein is a type ii integral membrane protein found in the golgi body. Two transcript variants encoding the same protein have been found for this gene. [Provided by refseqsequence: iakhgeparvlcnkdpftlkssvylsrlfpnskfllmvrdgrasvhsmitrkvtiagfdlssyrdcltkwnkaievmyaqcmevgkekclpvyyeqlvlhprrslklildflgiawsdavlhhedligkpggvslskierstdqvikpvnlealskwtghipgdvvrdmaqiapmlaqlgy
Additional Information
| SKU | 10287557 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21351 |
