Tnfsf12-Tnfsf13, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Tnfsf12-Tnfsf13, Each
$ 1,757.70
|
|
Details
This gene encodes a member of the tumor necrosis factor superfamily. It encodes a hybrid protein composed of the cytoplasmic and transmembrane domains of family member 12 fused to the c-terminal domain of family member 13. The hybrid protein is membrane anchored and presents the receptor-binding domain of family member 13 at the cell surface. It stimulates cycling in t- and b-lymphoma cell lines. [Provided by refseqsequence: leawengersrkrravltqkqkkqhsvlhlvpinatskddsdvtevmwqpalrrgrglqaqgygvriqdagvyllysqvlfqdvtftmgqvvsregqgrqetlfrcirsmpshpdraynscysagvfhlhqgdils
Additional Information
| SKU | 10292132 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB28217 |
