Tnfrsf13b Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Tnfrsf13b, Each
$ 1,757.70
|
|
Details
The protein encoded by this gene is a lymphocyte-specific member of the tumor necrosis factor (tnf) receptor superfamily. It interacts with calcium-modulator and cyclophilin ligand (caml). The protein induces activation of the transcription factors nfat, ap1, and nf-kappa-b and plays a crucial role in humoral immunity by interacting with a tnf ligand. This gene is located within the smith-magenis syndrome region on chromosome 17. [Provided by refseqsequence: acflkkrgdpcscqprsrprqspakssqdhameagspvstspepvetcsfcfpecraptqesavtpgtpdptcagrwgchtrttvlqpcphipdsglgivcvpaqe
Additional Information
| SKU | 10288509 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22449 |
