TIMM10, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant TIMM10, Each
$ 1,101.60
|
|
Details
TIMM10 belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophobic membrane proteins into the mitochondrial inner membrane.[supplied by OMIMSequence: MDPLRAQQLAAELEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERMGKKLTELSMQDEELMKRVQQSSGPA
Additional Information
| SKU | 10282389 |
|---|---|
| UOM | Each |
| UNSPSC | 12161500 |
| Manufacturer Part Number | PAB23466 |
| CAS Number | 64-17-5 |
| HS Code | 2207100000 |
|---|---|
| UN Number | UN 1170 |
| Proper Shipping Name | Ethanol |
| Packaging Group | PG II |
| Commodity Code | 526, 527 |
| DG or HZ | DG |
| Hazardous Class | 3 |
| Label | ![]() |
| Molecular Formula | C2H6O |
| EC Number | 200-578-6 |
| HIN | 33 |
| Hazard Statement | H225-H319 |
| Precautionary Statements | P280a-P303+P361+P353-P405-P501a-P210-P280-P305+P351+P338-P337+P313-P403+P235-P370+P378-P308+P311-P260-P301+P310-P311 |
| Risk Statements | 11-10-36/37/38-39/23/24/25-23/24/25-68/20/21/22-20/21/22-52/53-51/53 |
| GHS | GHS02,GHS07 |
| GHS (Pictogram) | ![]() ![]() |
| Safety Statements | 16-7-36-26-45-36/37-61-24/25-2017/7/16 |
| Hazard Code | F,T,Xn,N |
| Signal Word | Danger |



