518-831-8000 sales@utechproducts.com

Tgfbr3, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Tgfbr3, Each

1,757.70

Details

Transforming growth factor (tgf)-beta is a multifunctional cytokine that modulates several tissue development and repair processes, including cell differentiation, cell cycle progression, cellular migration, adhesion, and extracellular matrix production. Three tgf-beta forms are encoded by separate genes: tgfb1 (mim 190180), tgfb2 (mim 190220), and tgfb3 (mim 190230). The diverse effects of tgf-beta are mediated by the tgf-beta receptors and cell surface-binding proteins. Three tgf-beta receptors exist: type i (tgfbr1; mim 190181), type ii (tfgbr2; mim 190182), and type iii (tgfbr3). Tgfbr3 is a glycoprotein that binds tgfb and exists in both a membrane-bound and a soluble form (johnson et al., 1995 [Pubmed 8530052]).[Supplied by omimsequence: gysgmdvtlldptckakmngthfvlesplngcgtrprwsaldgvvyynsiviqvpalgdssgwpdgyedlesgdngfpgdmdegdaslftrpeivvfncslqqvrnpssfqeqphgnitfnmelyntdlf

Additional Information

SKU 10286749
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20417