Taf4b, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Taf4b, Each
$ 1,757.70
|
|
Details
Tata-binding protein associated factors (tafs) participate, with tata binding protein (tbp; mim 600075), in the formation of the tfiid protein complex (see mim 313650), which is involved in the initiation of gene transcription by rna polymerase ii (see mim 180660).[Supplied by omimsequence: phlvpflkksvvalrqllpnsqsfiqqcvqqtssdmviatctttvttspvvtttvsssqseksiivsgataprtvsvqtlnplagpvgakagvvtlhsvgptaatggttagtgllqtskplvtsvantvttvslqpekpvvsgtavt
Additional Information
| SKU | 10288325 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22229 |
