Sult4a1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Sult4a1, Each
$ 1,757.70
|
|
Details
This gene encodes a member of the sulfotransferase family. The encoded protein is a brain-specific sulfotransferase believed to be involved in the metabolism of neurotransmitters. Polymorphisms in this gene may be associated with susceptibility to schizophrenia. [Provided by refseqsequence: gefeskyfefhgvrlppfcrgkmeeianfpvrpsdvwivtypksgtsllqevvylvsqgadpdeiglmnideqlpvleypqpgldiikeltsprlikshlpyrflpsdlhngdskviymarnpkdlvvsyyqfhrsl
Additional Information
| SKU | 10292574 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB28739 |
