518-831-8000 sales@utechproducts.com

Stt3b, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Stt3b, Each

1,757.70

Details

The simp protein contains a highly immunogenic minor histocompatibility antigen epitope of 9 amino acids, b6(dom1). Like itm1 (mim 601134), simp is homologous to yeast stt3, an oligosaccharyltransferase essential for cell proliferation (mcbride et al., 2002 [Pubmed 12439619]).[Supplied by omimsequence: nppvedssdeddkrnqgnlydkagkvrkhateqekteeglgp

Additional Information

SKU 10289018
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23044