Stox1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Stox1, Each
$ 1,757.70
|
|
Details
The protein encoded by this gene may function as a dna binding protein. Mutations in this gene are associated with pre-eclampsia/eclampsia 4 (pee4). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [Provided by refseqsequence: sefqpgsirlekhpklpatqpiprikspnemvgqkplgeittvlgshliykkrisnpfqglshrgstiskghkiqktsdlkpsqtgpkek
Additional Information
| SKU | 10289132 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB23175 |
