Stard3nl, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Stard3nl, Each
$ 1,757.70
|
|
Details
Stard3nl is a late endosomal protein that interacts with mln64 (stard3; mim 607048) and may mediate endosomal cholesterol transport (alpy et al., 2002 [Pubmed 12393907]; alpy and tomasetto, 2006 [pubmed 16709157]).[Supplied by omimsequence: mnhlpedmenaltgsqsshaslrnihsinptqlmariesyegrekkgisdvrr
Additional Information
| SKU | 10287307 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21065 |
