St3gal6 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant St3gal6, Each
$ 1,757.70
|
|
Details
Sialyltransferases, such as st3gal6, catalyze the transfer of sialic acid from cytidine 5-prime monophospho-n-acetylneuraminic acid (cmp-neuac) to terminal positions of glycoprotein and glycolipid carbohydrate groups. Terminal neuac residues are key determinants of carbohydrate structures, such as the sialyl-lewis x determinants, and are widely distributed in many cell types.[Supplied by omimsequence: iqpclskpafasllrfhqfhpflcaadfrkiaslygsdkfdlpygmrtsaeyfrlalsklqscdlfdefdnipckkcvvvgnggvlknktlgekidsydviirmnng
Additional Information
| SKU | 10292012 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB28018 |
