518-831-8000 sales@utechproducts.com

Sox9 Rabbit Anti-Human, Mouse, Rat, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Sox9, Each

1,433.70

Details

The protein encoded by this gene recognizes the sequence ccttgag along with other members of the hmg-box class dna-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-muellerian hormone (amh) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal. [Provided by refseqsequence: sqrthikteqlspshyseqqqhspqqiayspfnlphyspsyppitrsqydytdhqnsssyyshaagqgtglystftymnpaqrpmytpiadtsgvpsipqthspqhweqpvytqltr

Additional Information

SKU 10292363
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28483