518-831-8000 sales@utechproducts.com

Snrpd3, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Snrpd3, Each

1,750.95

Details

The protein encoded by this gene belongs to the small nuclear ribonucleoprotein core protein family. It is required for pre-mrna splicing and small nuclear ribonucleoprotein biogenesis. [Provided by refseqsequence: kvlheaeghivtcetntgevyrgklieaednmncqmsnitvtyrdgrvaqleqvyirgskirflilpdmlknapmlksmknknqgsgagrgkaailkaqvaargrgrgmgrgni

Additional Information

SKU 10286411
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20038