Snrnp40 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Snrnp40, Each
$ 1,757.70
|
|
Details
This gene encodes a component of the u5 small nuclear ribonucleoprotein (snrnp) particle. The u5 snrnp is part of the spliceosome, a multiprotein complex that catalyzes the removal of introns from pre-messenger rnas. [Provided by refseqsequence: qgnvhnfeknllrcswspdgskiaagsadrfvyvwdttsrrilyklpghagsinevafhpdepiiisassdkrlymgeiq
Additional Information
| SKU | 10287968 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21803 |
