Slirp Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Slirp, Each
$ 1,757.70
|
|
Details
Steroid receptor rna activator (sra, or sra1; mim 603819) is a complex rna molecule containing multiple stable stem-loop structures that functions in coactivation of nuclear receptors. Slirp interacts with stem-loop structure-7 of sra (str7) and modulates nuclear receptor transactivation (hatchell et al., 2006 [Pubmed 16762838]).[Supplied by omimsequence: lrrsinqpvafvrripwtaassqlkehfaqfghvrrcilpfdketgfhrglgwvqfsseeglrnalqqenhiidgvkvqvhtrrpklpqtsdd
Additional Information
| SKU | 10287502 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21287 |
