Slc30a7, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Slc30a7, Each
$ 1,757.70
|
|
Details
Zinc functions as a cofactor for numerous enzymes, nuclear factors, and hormones and as an intra- and intercellular signal ion. Members of the zinc transporter (znt)/slc30 subfamily of the cation diffusion facilitator family, such as slc30a7, permit cellular efflux of zinc (seve et al., 2004 [Pubmed 15154973]).[Supplied by omimsequence: hgghghshgsghghshslfngaldqahghvdhchshevkhgaahshdhahghghfhshdgpslkettgpsrqi
Additional Information
| SKU | 10287250 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21003 |
