518-831-8000 sales@utechproducts.com

Slc30a7, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Slc30a7, Each

1,757.70

Details

Zinc functions as a cofactor for numerous enzymes, nuclear factors, and hormones and as an intra- and intercellular signal ion. Members of the zinc transporter (znt)/slc30 subfamily of the cation diffusion facilitator family, such as slc30a7, permit cellular efflux of zinc (seve et al., 2004 [Pubmed 15154973]).[Supplied by omimsequence: hgghghshgsghghshslfngaldqahghvdhchshevkhgaahshdhahghghfhshdgpslkettgpsrqi

Additional Information

SKU 10287250
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21003