518-831-8000 sales@utechproducts.com

Six5 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Six5, Each

1,757.70

Details

The protein encoded by this gene is a homeodomain-containing transcription factor that appears to function in the regulation of organogenesis. This gene is located downstream of the dystrophia myotonica-protein kinase gene. Mutations in this gene are a cause of branchiootorenal syndrome type 2. [Provided by refseqsequence: vvptsqvvtlpqavgplqllaagpgspvkvaaaagpanvhlinsgvgvtalqlpsatapgnfllanpvsgspivtgvavqqgkiiltatfptsmlvsqvlp

Additional Information

SKU 10289776
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23896