Selm, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Selm, Each
$ 1,757.70
|
|
Details
This gene encodes a selenoprotein, which contains a selenocysteine (sec) residue at its active site. The selenocysteine is encoded by the uga codon that normally signals translation termination. The 3' utr of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (secis), that is necessary for the recognition of uga as a sec codon rather than as a stop signal. This gene is expressed in a variety of tissues, and the protein is localized to the perinuclear structures. [Provided by refseqsequence: qdipfyhnlvmkhlpgadpelvllgrryeeleriplsemtreeinalvqelgfyrkaapdaqvppeyvwapakppeetsdha
Additional Information
| SKU | 10291701 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB27474 |
