Sec14l1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Sec14l1, Each
$ 1,757.70
|
|
Details
The protein encoded by this gene belongs to the sec14 cytosolic factor family. It has similarity to yeast sec14 and to japanese flying squid ralbp which suggests a possible role of the gene product in an intracellular transport system. Multiple alternatively spliced transcript variants have been found for this gene. [Provided by refseqsequence: svfkgapheiliqivdassvitwdfdvckgdivfniyhskrspqppkkdslgahsitspggnnvqlidkvwqlgrdysmvesplickegesvqg
Additional Information
| SKU | 10288308 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22209 |
