Sdhb, Subunit B, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Sdhb, Subunit B, Each
$ 1,757.70
|
|
Details
Complex ii of the respiratory chain, which is specifically involved in the oxidation of succinate, carries electrons from fadh to coq. The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane. The iron-sulfur subunit is highly conserved and contains three cysteine-rich clusters which may comprise the iron-sulfur centers of the enzyme. Sporadic and familial mutations in this gene result in paragangliomas and pheochromocytoma, and support a link between mitochondrial dysfunction and tumorigenesis. [Provided by refseqsequence: egkqqylqsieerekldglyecilcaccstscpsywwngdkylgpavlmqayrwmidsrddfteerlaklqdpfslyrchtimnctrtcpkglnpgkaiaeikkmmaty
Additional Information
| SKU | 10292535 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB28696 |
