Scrt1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Scrt1, Each
$ 1,757.70
|
|
Details
This gene is a member of the snail family of c2h2-type zinc finger transcription factors. It codes for a neural-specific transcriptional repressor that binds to e-box motifs. The protein may promote neural differention and may be involved in cancers with neuroendocrine features. [Provided by refseqsequence: lhdkgylsdyvgpssvydgdaeaallkgpspepmyaaavrgelgp
Additional Information
| SKU | 10290081 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB24402 |
