Scrg1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Scrg1, Each
$ 1,757.70
|
|
Details
Scrapie-responsive gene 1 is associated with neurodegenerative changes observed in transmissible spongiform encephalopathies. It may play a role in host response to prion-associated infections. The scrapie responsive protein 1 may be partly included in the membrane or secreted by the cells due to its hydrophobic n-terminus. [Provided by refseqsequence: kdhnchnlpegvadltqidvnvqdhfwdgkgcemicycnfsellccpkdvffgpkisfvipcnnq
Additional Information
| SKU | 10286939 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB20631 |
