Rpgrip1l, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Rpgrip1l, Each
$ 1,757.70
|
|
Details
The protein encoded by this gene can localize to the basal body-centrosome complex or to primary cilia and centrosomes in ciliated cells. The encoded protein has been found to interact with nephrocystin-4. Defects in this gene are a cause of joubert syndrome type 7 (jbts7) and meckel syndrome type 5 (mks5). Two transcript variants encoding different isoforms have been found for this gene. [Provided by refseqsequence: kntitlevhqaysteyetiaacqlkfheileksgrifctasligtkgdipnfgtveywfrlrvpmdqairlyrerakalgyitsnfkgpehmqslsqqapktaqlsstdstdgnl
Additional Information
| SKU | 10289450 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB23540 |
