Rnf43, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Rnf43, Each
$ 1,757.70
|
|
Details
Rnf43 is a hap95 (akap8l; mim 609475) binding ubiquitin ligase that promotes cell growth and is upregulated in colon cancer (yagyu et al., 2004 [Pubmed 15492824]; sugiura et al., 2008 [Pubmed 18313049]).[Supplied by omimsequence: cvdpwlhqhrtcplcmfnitegdsfsqslgpsrsyqepgrrlhlirqhpghahyhlpaayllgpsrsavarpprpgpflpsqepgmgprhhrfpraahprapgeqqrlagaqhpyaqgwglshlqstsqh
Additional Information
| SKU | 10286741 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB20409 |
