Rnf216 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Rnf216, Each
|
|
Details
This gene encodes a cytoplasmic protein which specifically colocalizes and interacts with the serine/threonine protein kinase, receptor-interacting protein (rip). Zinc finger domains of the encoded protein are required for its interaction with rip and for inhibition of tnf- and il1-induced nf-kappa b activation pathways. The encoded protein may also function as an e3 ubiquitin-protein ligase which accepts ubiquitin from e2 ubiquitin-conjugating enzymes and transfers it to substrates. Several alternatively spliced transcript variants have been described for this locus but the full-length natures of only some are known. [Provided by refseqsequence: kviileegsllytesdpletqnqssedsetellsnlgesaaladdqaieedcwldhpyfqslnqqpreitnqvvpqerqpeaelgrllfqhefpgpafp
Additional Information
| SKU | 10287563 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21357 |
