518-831-8000 sales@utechproducts.com

Rnf216 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Rnf216, Each

1,757.70

Details

This gene encodes a cytoplasmic protein which specifically colocalizes and interacts with the serine/threonine protein kinase, receptor-interacting protein (rip). Zinc finger domains of the encoded protein are required for its interaction with rip and for inhibition of tnf- and il1-induced nf-kappa b activation pathways. The encoded protein may also function as an e3 ubiquitin-protein ligase which accepts ubiquitin from e2 ubiquitin-conjugating enzymes and transfers it to substrates. Several alternatively spliced transcript variants have been described for this locus but the full-length natures of only some are known. [Provided by refseqsequence: kviileegsllytesdpletqnqssedsetellsnlgesaaladdqaieedcwldhpyfqslnqqpreitnqvvpqerqpeaelgrllfqhefpgpafp

Additional Information

SKU 10287563
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21357