Rmi2, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Rmi2, Each
$ 1,757.70
|
|
Details
Rmi2 is a component of the blm (recql3; mim 604610) complex, which plays a role in homologous recombination-dependent dna repair and is essential for genome stability (xu et al., 2008 [Pubmed 18923082]).[Supplied by omimsequence: gkyvmvmgvvqacspepclqavkmtdlsdnpihesmwelevedlhrni
Additional Information
| SKU | 10289623 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB23731 |
