Rc3h1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Rc3h1, Each
$ 1,757.70
|
|
Details
Rc3h1, or roquin, encodes a highly conserved member of the ring type ubiquitin ligase protein family (vinuesa et al., 2005 [Pubmed 15917799]). The roquin protein is distinguished by the presence of a ccch zinc finger found in rna-binding proteins, and localization to cytosolic rna granules implicated in regulating mrna translation and stability.[Supplied by omimsequence: ppsapepappyldhyppylqervvnsqygtqpqqyppiypshydgrrvypapsytreeifrespipieippaavpsyvpesreryqqiesyypvaphptqirp
Additional Information
| SKU | 10288164 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22037 |
