518-831-8000 sales@utechproducts.com

Rc3h1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Rc3h1, Each

1,757.70

Details

Rc3h1, or roquin, encodes a highly conserved member of the ring type ubiquitin ligase protein family (vinuesa et al., 2005 [Pubmed 15917799]). The roquin protein is distinguished by the presence of a ccch zinc finger found in rna-binding proteins, and localization to cytosolic rna granules implicated in regulating mrna translation and stability.[Supplied by omimsequence: rtsktiyqgagpmqamapqgaptksinisdyspygthggwgaspysphqnipsqghfsererismsevashgkplpsaereqlrlelqqlnhqisqqtq

Additional Information

SKU 10288163
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22034