Rasgrf2, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Rasgrf2, Each
$ 1,757.70
|
|
Details
Ras (mim 190020) gtpases cycle between an inactive gdp-bound state and an active gtp-bound state. Guanine-nucleotide exchange factors (gefs), such as rasgrfs, stimulate the conversion of the gdp-bound form into the active form.[Supplied by omimsequence: fatsqnnrgehlvdgksprlcrkfssppplavsrtsspvrarklsltsplnskigaldlttssspttttqspaasppphtgqipldlsrglsspeqspgtveenvd
Additional Information
| SKU | 10287404 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21172 |
