518-831-8000 sales@utechproducts.com

Rasgrf2, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Rasgrf2, Each

1,757.70

Details

Ras (mim 190020) gtpases cycle between an inactive gdp-bound state and an active gtp-bound state. Guanine-nucleotide exchange factors (gefs), such as rasgrfs, stimulate the conversion of the gdp-bound form into the active form.[Supplied by omimsequence: fatsqnnrgehlvdgksprlcrkfssppplavsrtsspvrarklsltsplnskigaldlttssspttttqspaasppphtgqipldlsrglsspeqspgtveenvd

Additional Information

SKU 10287404
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21172