Psmc5 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Psmc5, Each
|
|
Details
The 26s proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20s core and a 19s regulator. The 20s core is composed of 4 rings of 28 nonidentical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19s regulator is composed of a base, which contains 6 atpase subunits and 2 non-atpase subunits, and a lid, which contains up to 10 non-atpase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an atp/ubiquitin-dependent process in a nonlysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class i mhc peptides. This gene encodes one of the atpase subunits, a member of the triple-a family of atpases which have a chaperone-like activity. In addition to participation in proteasome functions, this subunit may participate in transcriptional regulation since it has been shown to interact with the thyroid hormone receptor and retinoid x receptor-alpha. [Provided by refseqsequence: ldsallrpgridrkiefpppneearldilkihsrkmnltrginlrkiaelmpgasgaevkgvcteagmyalrerrvhvtqedfemavakvmqkdseknmsikklwk
Additional Information
| SKU | 10287222 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB20968 |
