518-831-8000 sales@utechproducts.com

Pmm1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Pmm1, Each

1,757.70

Details

Phosphomannomutase catalyzes the conversion between d-mannose 6-phosphate and d-mannose 1-phosphate which is a substrate for gdp-mannose synthesis. Gdp-mannose is used for synthesis of dolichol-phosphate-mannose, which is essential for n-linked glycosylation and thus the secretion of several glycoproteins as well as for the synthesis of glycosyl-phosphatidyl-inositol (gpi) anchored proteins. [Provided by refseqsequence: mavtaqaarrkervlclfdvdgtltparqkidpevaaflqklrsrvqigvvggsdy

Additional Information

SKU 10288781
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22761