Pmm1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Pmm1, Each
$ 1,757.70
|
|
Details
Phosphomannomutase catalyzes the conversion between d-mannose 6-phosphate and d-mannose 1-phosphate which is a substrate for gdp-mannose synthesis. Gdp-mannose is used for synthesis of dolichol-phosphate-mannose, which is essential for n-linked glycosylation and thus the secretion of several glycoproteins as well as for the synthesis of glycosyl-phosphatidyl-inositol (gpi) anchored proteins. [Provided by refseqsequence: mavtaqaarrkervlclfdvdgtltparqkidpevaaflqklrsrvqigvvggsdy
Additional Information
| SKU | 10288781 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22761 |
